SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 399741.Spro_0180 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399741.Spro_0180
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.52e-38
Family Frataxin-like 0.00000651
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 399741.Spro_0180
Sequence length 106
Comment (Serratia proteamaculans 568)
Sequence
MNDSEFHQLADQLMLNIEETLDDFDGDADIDYETNGGVMTLSFENGTKIVINRQEPLHQV
WLATKTGGYHFNYRDGVWLCDRSDRAFYPLLSEAASAQAGEEVKFA
Download sequence
Identical sequences A8G850
WP_012004651.1.18676 WP_012004651.1.35080 399741.Spro_0180 gi|157368429|ref|YP_001476418.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]