SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 399741.Spro_1520 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  399741.Spro_1520
Domain Number 1 Region: 14-136
Classification Level Classification E-value
Superfamily PapD-like 9.42e-42
Family Pilus chaperone 0.00011
Further Details:      
 
Domain Number 2 Region: 130-221
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 1.57e-18
Family Periplasmic chaperone C-domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 399741.Spro_1520
Sequence length 227
Comment (Serratia proteamaculans 568)
Sequence
MKKVLSCILLAFSVNAFAGIQVDSTRVIYNSGSKSASLSISNDSDDTYMVQTWLDTGDSS
QMPKNLPIVVTPPILKLAAKKDAILRFIYSGSGLPQDRESLLWVNVQEIPPTPKQDNVLQ
VAIRTRIKLFYRPEALKANLQQQAEALKWQRQGGNLVVTNNGPLYVTLGVLTLKSGGKSW
KVNADMVKPQDSLKIALPQGAQSAGSMSFTYINDYGGHTEIKNVALN
Download sequence
Identical sequences A8GBY4
WP_012005953.1.18676 WP_012005953.1.35080 gi|157369763|ref|YP_001477752.1| 399741.Spro_1520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]