SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 400667.A1S_0962 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  400667.A1S_0962
Domain Number 1 Region: 4-304
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 8.03e-109
Family Glutaminase 0.00000244
Further Details:      
 
Domain Number 2 Region: 327-398
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000255
Family Anti-sigma factor antagonist SpoIIaa 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 400667.A1S_0962
Sequence length 440
Comment (Acinetobacter baumannii ATCC 17978)
Sequence
MKTPLPDYLANVIEACDIDNSGHLADYIPELANANPNRLALAMSTVDGEIYSVGDDDVEF
TIQSISKPFVYAYVLQQLGIDAVLAKVGVEPSGEAFNEISLGKDGRPKNPMINSGAITVH
SLIQVKHGLHSAEILRRFMSELAGRELSFDESVYDSEVKTAYRNLSIGYMLRTVGILETD
PVDIVNGYIRQCAIMVTVKDLVRMGSVLANGGVDPKTGKRLLNRSVVRQVLSVMMSCGMY
DAAGDWLSTVGIPAKSGVAGGILGVLPGQVSIAAFSPRLDEHGHSVRGIDILERLSRDMG
LHLMEGTPSAQTIVQSHYRTGKDASLSVYVLRGVLKFTEAEMLLRILQDETTDQSTIVID
LTQISLIHDVGKRMFLEGVDRLIDDGHTLVLVDPEQRLDHARTAKDRELHVYHDFDDLLE
KHEIRSKKKTYSDIAALLNC
Download sequence
Identical sequences A0A062EYU4 A0A090C211 A0A0J1CXS7 A0A0R4J7Y0 A0A158LRW2 A0A171EVY5
WP_000856715.1.100152 WP_000856715.1.100157 WP_000856715.1.100567 WP_000856715.1.101069 WP_000856715.1.101338 WP_000856715.1.101409 WP_000856715.1.10832 WP_000856715.1.11305 WP_000856715.1.12477 WP_000856715.1.13109 WP_000856715.1.13480 WP_000856715.1.13635 WP_000856715.1.13850 WP_000856715.1.15066 WP_000856715.1.15713 WP_000856715.1.16288 WP_000856715.1.16701 WP_000856715.1.16787 WP_000856715.1.16850 WP_000856715.1.17002 WP_000856715.1.1753 WP_000856715.1.18887 WP_000856715.1.1893 WP_000856715.1.20066 WP_000856715.1.21167 WP_000856715.1.23674 WP_000856715.1.24292 WP_000856715.1.24586 WP_000856715.1.2475 WP_000856715.1.24916 WP_000856715.1.25131 WP_000856715.1.25638 WP_000856715.1.26701 WP_000856715.1.27220 WP_000856715.1.27840 WP_000856715.1.28236 WP_000856715.1.28420 WP_000856715.1.28581 WP_000856715.1.28881 WP_000856715.1.29461 WP_000856715.1.29779 WP_000856715.1.30068 WP_000856715.1.30466 WP_000856715.1.31121 WP_000856715.1.3225 WP_000856715.1.32532 WP_000856715.1.32983 WP_000856715.1.33308 WP_000856715.1.33759 WP_000856715.1.35663 WP_000856715.1.36122 WP_000856715.1.37345 WP_000856715.1.37386 WP_000856715.1.37553 WP_000856715.1.37803 WP_000856715.1.39159 WP_000856715.1.39901 WP_000856715.1.39927 WP_000856715.1.40497 WP_000856715.1.41026 WP_000856715.1.41878 WP_000856715.1.42581 WP_000856715.1.43088 WP_000856715.1.43766 WP_000856715.1.44058 WP_000856715.1.44964 WP_000856715.1.45239 WP_000856715.1.45291 WP_000856715.1.46080 WP_000856715.1.46337 WP_000856715.1.46553 WP_000856715.1.46887 WP_000856715.1.4733 WP_000856715.1.47436 WP_000856715.1.47607 WP_000856715.1.47937 WP_000856715.1.48320 WP_000856715.1.48527 WP_000856715.1.4855 WP_000856715.1.48925 WP_000856715.1.48977 WP_000856715.1.49228 WP_000856715.1.49463 WP_000856715.1.49673 WP_000856715.1.5 WP_000856715.1.50111 WP_000856715.1.50216 WP_000856715.1.50807 WP_000856715.1.51314 WP_000856715.1.51378 WP_000856715.1.51592 WP_000856715.1.51709 WP_000856715.1.52030 WP_000856715.1.52342 WP_000856715.1.5300 WP_000856715.1.53076 WP_000856715.1.53539 WP_000856715.1.54138 WP_000856715.1.54300 WP_000856715.1.54464 WP_000856715.1.54492 WP_000856715.1.54718 WP_000856715.1.54885 WP_000856715.1.54906 WP_000856715.1.55045 WP_000856715.1.55447 WP_000856715.1.55631 WP_000856715.1.56154 WP_000856715.1.57423 WP_000856715.1.57731 WP_000856715.1.58159 WP_000856715.1.58503 WP_000856715.1.58802 WP_000856715.1.59232 WP_000856715.1.59281 WP_000856715.1.59456 WP_000856715.1.59944 WP_000856715.1.60109 WP_000856715.1.60484 WP_000856715.1.60546 WP_000856715.1.60678 WP_000856715.1.60933 WP_000856715.1.61759 WP_000856715.1.62435 WP_000856715.1.62817 WP_000856715.1.6289 WP_000856715.1.63224 WP_000856715.1.63344 WP_000856715.1.63537 WP_000856715.1.63649 WP_000856715.1.63906 WP_000856715.1.64044 WP_000856715.1.6458 WP_000856715.1.64586 WP_000856715.1.64646 WP_000856715.1.65154 WP_000856715.1.65556 WP_000856715.1.65872 WP_000856715.1.66691 WP_000856715.1.66771 WP_000856715.1.67003 WP_000856715.1.67823 WP_000856715.1.68024 WP_000856715.1.68086 WP_000856715.1.68705 WP_000856715.1.68933 WP_000856715.1.69859 WP_000856715.1.70461 WP_000856715.1.70993 WP_000856715.1.71347 WP_000856715.1.71679 WP_000856715.1.71898 WP_000856715.1.72010 WP_000856715.1.72577 WP_000856715.1.73031 WP_000856715.1.73392 WP_000856715.1.73737 WP_000856715.1.73938 WP_000856715.1.74322 WP_000856715.1.74324 WP_000856715.1.74361 WP_000856715.1.74944 WP_000856715.1.74949 WP_000856715.1.75162 WP_000856715.1.75416 WP_000856715.1.75478 WP_000856715.1.75620 WP_000856715.1.75896 WP_000856715.1.76571 WP_000856715.1.76585 WP_000856715.1.77226 WP_000856715.1.77233 WP_000856715.1.77396 WP_000856715.1.78094 WP_000856715.1.78968 WP_000856715.1.78984 WP_000856715.1.79242 WP_000856715.1.79254 WP_000856715.1.7947 WP_000856715.1.79470 WP_000856715.1.79789 WP_000856715.1.8108 WP_000856715.1.82036 WP_000856715.1.82355 WP_000856715.1.82371 WP_000856715.1.82838 WP_000856715.1.82967 WP_000856715.1.83024 WP_000856715.1.83297 WP_000856715.1.83452 WP_000856715.1.83504 WP_000856715.1.839 WP_000856715.1.83900 WP_000856715.1.84099 WP_000856715.1.84173 WP_000856715.1.84318 WP_000856715.1.85359 WP_000856715.1.85449 WP_000856715.1.85683 WP_000856715.1.86869 WP_000856715.1.87319 WP_000856715.1.87805 WP_000856715.1.88040 WP_000856715.1.89410 WP_000856715.1.89643 WP_000856715.1.89876 WP_000856715.1.9008 WP_000856715.1.90399 WP_000856715.1.91061 WP_000856715.1.91627 WP_000856715.1.91832 WP_000856715.1.91906 WP_000856715.1.92611 WP_000856715.1.92665 WP_000856715.1.93437 WP_000856715.1.93485 WP_000856715.1.94012 WP_000856715.1.94129 WP_000856715.1.94816 WP_000856715.1.95001 WP_000856715.1.96741 WP_000856715.1.97180 WP_000856715.1.97300 WP_000856715.1.9733 WP_000856715.1.98369 WP_000856715.1.99395 WP_000856715.1.99770 gi|229577100|ref|YP_001083996.2| gi|169796842|ref|YP_001714635.1| 400667.A1S_0962 509173.ABAYE2832 557600.ABBFA_002649 gi|215484318|ref|YP_002326547.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]