SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 404380.Gbem_2417 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  404380.Gbem_2417
Domain Number 1 Region: 144-366
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.57e-49
Family D-glucarate dehydratase-like 0.0003
Further Details:      
 
Domain Number 2 Region: 6-126
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.23e-23
Family Enolase N-terminal domain-like 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 404380.Gbem_2417
Sequence length 368
Comment (Geobacter bemidjiensis Bem)
Sequence
MDISFQIQDAVASVIRAPLASPFRIATGQHDELENVFLKLTTRDGVSGYGEAAVASHITG
ETVPGTLANLQNAAAALRGQTVDDAESACRQFAAAFAGNHAGLAALEMALLDLSSRVRGI
PFYRLFAPVAALEPRLAFSTDITVVIGSLDEARATAREFASRGFKAFKIKIGRDEQLDLA
RVLAVHEIAPDSQIILDANMGFSAGSMLAFLDRLAAKGVRPVLLEQPVPKMDWDGLSEIT
AALTGSETLVCADESVGSLADARRAIDSNAVSAINVKFMKSGILEGAEIARLAASRGIRL
MLGAMMESALAVTASAHFAAGLACFDYLDMDTTFFLKGELAHSPYLDEHGRFDLHDAGPG
IGVEPRFS
Download sequence
Identical sequences B5EFW2
NYSGXRC-9448b gi|197118796|ref|YP_002139223.1| 404380.Gbem_2417 WP_012530849.1.31571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]