SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 410358.Mlab_0941 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  410358.Mlab_0941
Domain Number 1 Region: 204-497
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 8.02e-114
Family AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC 0.00000148
Further Details:      
 
Domain Number 2 Region: 3-187
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 9.39e-62
Family Inosicase 0.0000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 410358.Mlab_0941
Sequence length 497
Comment (Methanocorpusculum labreanum Z)
Sequence
MTLALLSVWDKTGILDLARALVAKNIGILSSGGTAKALREAGIPAKDVSEYTQFPEMMDG
RVKTLHPKVHGGLLGRRGIDDDVMKAHFIEPIDILCVNLYPFEEMSKKNLPLEELIEFID
IGGPAMIRAASKNYKDVAVLTDPSDYPMAIEAIKTGGFTSEQKLRLATKAFTRTAAYDAA
ISNYLNGIDKEFPDVYTMQFGNGRKLRYGENPHQKAAVYGTSGIAGQVALQGKEMSYNNY
LDVHAAVSLCRELPGFATVIVKHNNPCGVALGKNQLESYIKARDVDPVSAYGSIVAMSTP
VDTDIAKEICSTFVEVLIAPSFSDEAREMMKKKENMRLLILPPAEPADEIRTIDGGILVQ
RTPAYTEDWKVVSKRAPTPDEVEALKLAWKVVEYAKSNAIIYANKTETVGIGVGQMNRVD
SAKLAIQKAAEFGRTMQGTVIASDAFLPFSDTLEVAAAAGATALIQPGGSIRDDEVLAKA
DELGIAMVFTGVRHFRH
Download sequence
Identical sequences A2SS05
gi|124485762|ref|YP_001030378.1| 410358.Mlab_0941 WP_011833314.1.86236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]