SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 41431.PCC8801_0969 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  41431.PCC8801_0969
Domain Number 1 Region: 14-411
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 8.24e-139
Family ArgJ-like 0.000000745
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 41431.PCC8801_0969
Sequence length 414
Comment (Cyanothece PCC 8801)
Sequence
MTDWQEISGGITAPKGFKATGMAAGLKPSGNPDLALIVSETDAIAAGVFTTSQVRAACVD
YCRQRLQQKSSIRAILCNAGQANAATGEQGWQDALDSAQSIAQALNISHEEILLASTGVI
GQRIKMEALQKAIPQLVSNLSETGGDSAANAIMTTDLVPKSIALETIIDGRPVRIGGMAK
GSGMIHPNMATMLAFVTCDGLVTTHLWQQMLTEAANQSFNQITVDGDTSTNDTLIALANG
QSRTPTITEITSKDGQKLQAMLTAVCQYLAKAIARDGEGATCLVEVQVSGASDNEGARRI
AKTIAGSSLVKSAIFGRDPNWGRIAAAAGRAGVSFNQEELQIKLGHFLMMENGQPLTFDR
DAASNYLKQAAAGAYLKEDTVLISLCVGNGSGHGIAWGCDLSYDYVKINAEYTT
Download sequence
Identical sequences B7JZV2
gi|218245830|ref|YP_002371201.1| WP_012594320.1.62203 WP_012594320.1.93053 395962.Cyan8802_0998 41431.PCC8801_0969 gi|257058878|ref|YP_003136766.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]