SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 41514.SARI_03193 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  41514.SARI_03193
Domain Number 1 Region: 4-127
Classification Level Classification E-value
Superfamily YjgF-like 1.27e-43
Family YjgF/L-PSP 0.000000679
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 41514.SARI_03193
Sequence length 128
Comment (Salmonella enterica arizonae serovar 62 z4 z23 )
Sequence
MSKTIATENAPAAIGPYVQGVDLGSMVITSGQIPVDPKTGSVPEDVSAQARQSLENVKAI
VEAAGLKVGDIVKTTVFVKDLNDFATVNATYEAFFTEHNATFPARSCVEVARLPKDVKIE
IEAIAVRR
Download sequence
Identical sequences A0A1X2TI09 A9MEW4
gi|161505060|ref|YP_001572172.1| CP000880|CDS_3105332-3105718 WP_000047545.1.17694 WP_000047545.1.2915 WP_000047545.1.3208 WP_000047545.1.4114 WP_000047545.1.5907 WP_000047545.1.59204 WP_000047545.1.64036 WP_000047545.1.6558 WP_000047545.1.79300 WP_000047545.1.90617 41514.SARI_03193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]