SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 415426.Hbut_0666 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  415426.Hbut_0666
Domain Number 1 Region: 4-269
Classification Level Classification E-value
Superfamily SIS domain 2.92e-21
Family mono-SIS domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 415426.Hbut_0666
Sequence length 301
Comment (Hyperthermus butylicus)
Sequence
MANLAKYILSELERINAIVSEQLEHTKPLLEGAECIAAIGAGDSYAAALALEACSGGTAE
ALDPFDALYSGRLGRLARKGCILVALSVGGRTRAVLDVAQRYRELGGRVVAVTGPGTPLA
SLANDAVELVYTGLASGIGAARHVAMLAALAGLLGAQPQVANLDAPCELARADAYAGACE
AYSSAHYAELKRAEVWGEAAPSHRLEQLVHAPIYTAKTVAVYESSIASRDRQREALETLR
EAGFQVYTVPATGDCWSTILSQAAATLYCIAVRAENEKVEEPAYRRHPGLEHLTRLIYEM
S
Download sequence
Identical sequences A2BKL1
WP_011821840.1.50451 415426.Hbut_0666 gi|124027547|ref|YP_001012867.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]