SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 415426.Hbut_0829 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  415426.Hbut_0829
Domain Number 1 Region: 6-288
Classification Level Classification E-value
Superfamily Folate-binding domain 8.16e-74
Family Aminomethyltransferase folate-binding domain 0.00000363
Further Details:      
 
Domain Number 2 Region: 293-373
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 1.44e-21
Family Aminomethyltransferase beta-barrel domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 415426.Hbut_0829
Sequence length 378
Comment (Hyperthermus butylicus)
Sequence
MTGVKVPLYDVHRELGASLGEFAGWLVPIDYGSIVEEHVAVRKTVGFFDLSHMARIIVSG
PDAGKLLDKLVPRYLESEPGTMLGPTAFLNENAGFVDDVMLYNLGGNQWMIVANAVNREK
VLGWLNDWLSRLGFTASVEDKTLELAMFAVQGPKAAELMERLGAPREVLELKLLRFRLNV
ELSEAKARAFLVSRSGWTGEDGFEIIAPVGEAEKILRKAAEIVRELGGRLCGLGARDSLR
MEMGFVLYGHEIDEETTPVDARYWWVYQPGPKEDCVGCKALREALRRGAVKVRVGIRLSK
KARIVPRQGDKIYVEGVEVGHVTSGAYSPVLGRSIAQAYIKPSHALMGLTVEVERRGKRY
QGKIVDFPLVKPTSSPPL
Download sequence
Identical sequences A2BL20
WP_011821999.1.50451 gi|124027706|ref|YP_001013026.1| 415426.Hbut_0829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]