SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 416591.Tlet_0570 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  416591.Tlet_0570
Domain Number 1 Region: 195-445
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.37e-65
Family Pyruvate oxidase and decarboxylase Pyr module 0.094
Further Details:      
 
Domain Number 2 Region: 2-216
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.09e-32
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0037
Further Details:      
 
Domain Number 3 Region: 455-561
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000000000116
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 416591.Tlet_0570
Sequence length 564
Comment (Thermotoga lettingae TMO)
Sequence
MEYSFIIAGEAGQGIQTVEVLLPKIFKKAGLNVFSYKEYMSRVRGGSNSTLIRVSDIPVR
AFKQKADFALFLSNDVSHLKRISNRLSSDSILVVDEEFPGIDDTLKVLRIPLLKTASALG
NKIYANSVMIGFATALLGVDLENTLNIVKQYFSKKSKEVIFQNLEAVKSGYENGLASKKK
LSITKLKQNKQICDQFLLSGAEAVAFGALAGGCNFISSYPMSPSTGVLVQLAKLSDNFDL
IVEQTEDEISAINMALGAWYAGGRAMVTTSGGGFALMIEGLSLAGMIESPIVVHLAQRPG
PATGLPTRTEQADLMFALYAGHGEFPRVIYAPGNLEEAFLCSWKAFQIADKYQIPALILT
DQYLMDMIYNIENVPLPENIENYLIKTDSDYLRYKLTQKGISPRGIPGWGEGLVCVDSDE
HDESGRITEDFEMRKMMVEKRMKKMSNFKDYYTPELTGNSGYEVLAVCFGSTKEIVKEAA
QSFENIAVLHLVQLYPLPRDLKKYFDMAKKVVIIENNFTSQFASLLKTFANLDHSKKVTK
YDGMPFSVEEIKNVFEQFTEEGEV
Download sequence
Identical sequences A8F4Q2
gi|157363433|ref|YP_001470200.1| WP_012002617.1.90183 416591.Tlet_0570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]