SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 419942.YN1551_3180 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  419942.YN1551_3180
Domain Number 1 Region: 134-384
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 4.41e-22
Family Lambda integrase-like, catalytic core 0.019
Further Details:      
 
Weak hits

Sequence:  419942.YN1551_3180
Domain Number - Region: 7-47
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000305
Family Recombinase DNA-binding domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 419942.YN1551_3180
Sequence length 419
Comment (Sulfolobus islandicus Y N 15 51)
Sequence
MLIDISKLDEQQRKRIIKKLVEKLGLSQAAKMLDVGRSTLYRYVNSDQSIPLDIVRKAAE
MLASDELSDAIYGLKVVDVDFTTALSVVVKAMKDEKFRNFFVSILYQYLGDYLKNVSSTY
IVTEEDVKKFEKLLQGKSKSTIVMRMRYLRIALTKLGYELSPDSIRDLIAELSEDSSNVA
RHTANSLKLFIKTVVKEKNLQLAQLLYNSFKVPKSKYKYKPQPLSLETLRRIFDNIEHLG
AKAFFLLLSESGLRVGEVYSLKMDQLDLENRIIKVMKESETKRAYISFIHTETRKWLQEV
YFPYREEFIRTYEHVVGHIGADVEAWKQKLFPFQLADLRSSIKEGMRKVLGKEFRLYDLR
SFFASYLIKNGVSPMIVNILQGRAPPAQFQILQNHYFVMSEIELKKIFDEKGPKLLSPK
Download sequence
Identical sequences C3NN64
419942.YN1551_3180 gi|228288727|ref|YP_002841979.1| gi|228288727|ref|YP_002841979.1|NC_012624 WP_012718273.1.52267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]