SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 419947.MRA_0060 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  419947.MRA_0060
Domain Number 1 Region: 399-522,751-815
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 5.3e-43
Family Intein (protein splicing domain) 0.0027
Further Details:      
 
Domain Number 2 Region: 201-403
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.21e-39
Family RecA protein-like (ATPase-domain) 0.01
Further Details:      
 
Domain Number 3 Region: 22-133
Classification Level Classification E-value
Superfamily N-terminal domain of DnaB helicase 3.14e-37
Family N-terminal domain of DnaB helicase 0.00013
Further Details:      
 
Domain Number 4 Region: 601-701
Classification Level Classification E-value
Superfamily Homing endonucleases 1.59e-16
Family Intein endonuclease 0.014
Further Details:      
 
Weak hits

Sequence:  419947.MRA_0060
Domain Number - Region: 811-861
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0146
Family G proteins 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 419947.MRA_0060
Sequence length 874
Comment (Mycobacterium tuberculosis H37Ra)
Sequence
MAVVDDLAPGMDSSPPSEDYGRQPPQDLAAEQSVLGGMLLSKDAIADVLERLRPGDFYRP
AHQNVYDAILDLYGRGEPADAVTVAAELDRRGLLRRIGGAPYLHTLISTVPTAANAGYYA
SIVAEKALLRRLVEAGTRVVQYGYAGAEGADVAEVVDRAQAEIYDVADRRLSEDFVALED
LLQPTMDEIDAIASSGGLARGVATGFTELDEVTNGLHPGQMVIVAARPGVGKSTLGLDFM
RSCSIRHRMASVIFSLEMSKSEIVMRLLSAEAKIKLSDMRSGRMSDDDWTRLARRMSEIS
EAPLFIDDSPNLTMMEIRAKARRLRQKANLKLIVVDYLQLMTSGKKYESRQVEVSEFSRH
LKLLAKELEVPVVAISQLNRGPEQRTDKKPMLADLRESGCLTASTRILRADTGAEVAFGE
LMRSGERPMVWSLDERLRMVARPMINVFPSGRKEVFRLRLASGREVEATGSHPFMKFEGW
TPLAQLKVGDRIAAPRRVPEPIDTQRMPESELISLARMIGDGSCLKNQPIRYEPVDEANL
AAVTVSAAHSDRAAIRDDYLAARVPSLRPARQRLPRGRCTPIAAWLAGLGLFTKRSHEKC
VPEAVFRAPNDQVALFLRHLWSAGGSVRWDPTNGQGRVYYGSTSRRLIDDVAQLLLRVGI
FSWITHAPKLGGHDSWRLHIHGAKDQVRFLRHVGVHGAEAVAAQEMLRQLKGPVRNPNLD
SAPKKVWAQVRNRLSAKQMMDIQLHEPTMWKHSPSRSRPHRAEARIEDRAIHELARGDAY
WDTVVEITSIGDQHVFDGTVSGTHNFVANGISLHNSLEQDADVVILLHRPDAFDRDDPRG
GEADFILAKHRNGPTKTVTVAHQLHLSRFANMAR
Download sequence
Identical sequences A0A0T9MNR7 A5TYC9 I6WXB9 P9WMR3
gi|15607200|ref|NP_214572.1| gi|148659818|ref|YP_001281341.1| 419947.MRA_0060 83332.Rv0058 Rv0058 NP_214572.1.84033 WP_003916208.1.11596 WP_003916208.1.11960 WP_003916208.1.16108 WP_003916208.1.16141 WP_003916208.1.26098 WP_003916208.1.28202 WP_003916208.1.29339 WP_003916208.1.29698 WP_003916208.1.30888 WP_003916208.1.34255 WP_003916208.1.39239 WP_003916208.1.40922 WP_003916208.1.47207 WP_003916208.1.48419 WP_003916208.1.48648 WP_003916208.1.50235 WP_003916208.1.53230 WP_003916208.1.59961 WP_003916208.1.62021 WP_003916208.1.6295 WP_003916208.1.68433 WP_003916208.1.68576 WP_003916208.1.71329 WP_003916208.1.75665 WP_003916208.1.78322 WP_003916208.1.83409 WP_003916208.1.83470 WP_003916208.1.8426 WP_003916208.1.84488 WP_003916208.1.85823 WP_003916208.1.91207 WP_003916208.1.9139 WP_003916208.1.93245 WP_003916208.1.9368 gi|15607200|ref|NP_214572.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]