SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 426117.M446_6210 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  426117.M446_6210
Domain Number 1 Region: 4-188
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.93e-51
Family Methylesterase CheB, C-terminal domain 0.0000831
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 426117.M446_6210
Sequence length 342
Comment (Methylobacterium 4 46)
Sequence
MTNRDIIVIGGSAGATVPLKALLRALPADLPAAVLVVLHIPARSLGLLATVTSAASRLPV
ETAQDGMAIRPGHIYLGVPDRHLLLVDGVIRLGRGPRENMVRPAIDPLFRSAAIAYGPRV
IGVVLSGLLNDGAAGLDAIKACGGLALVQDPADAVADEMPLAALAAAAVDLAVPGARLGD
VLSDLARETPGPRLPVPPEIRIEVDIAAGERVGSGVLRQIADPAPLTCPHCCGVLSEVRG
SKPVRFRCQVGHALTAEALAKEQEAAVDEAMRVALRIVEERADLVARMAEDGRRSGRRAV
AEMYEARAAEYRGYGETIRRAILSAMPQPGAADPGDGNGEAG
Download sequence
Identical sequences B0UPQ1
WP_012335855.1.13143 WP_012335855.1.41957 gi|170744256|ref|YP_001772911.1| 426117.M446_6210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]