SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 426355.Mrad2831_6263 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  426355.Mrad2831_6263
Domain Number 1 Region: 4-189
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 9.02e-49
Family Methylesterase CheB, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 426355.Mrad2831_6263
Sequence length 340
Comment (Methylobacterium radiotolerans JCM 2831)
Sequence
MMNRDIIVIGGSSGATAPLKAILGALPGDLPAAVFVVVHIPARSLGLLATVTAAAAHMPV
HAARDGMAIAPGNIYLGVPDHHLIVRDGQMRLGRGPRENMARPSIDPLFRSAAAAYGSRV
IGVLLSGLLNDGAAGLEAIKRCGGIAIVQDPADAIADEMPLSGMAAASVDLALPSARLGD
VLSELVREPAGPRLPVPPEIRLEIDIAAGERIDSAVLRRIADPAALTCPHCSGVLSKVRD
AKPLRFRCQVGHAYTAEVVAKEQENAVDEALRVALRIIEERAELVARMAQDGRNSGRPAV
ADMYDDRAAEYRGYAETIRRAALLSLPEPESSGSEGAQEE
Download sequence
Identical sequences B1M9L1
WP_012329972.1.31760 gi|170745531|ref|YP_001766988.1| 426355.Mrad2831_6263 gi|170745531|ref|YP_001766988.1|NC_010510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]