SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 426368.MmarC7_1030 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  426368.MmarC7_1030
Domain Number 1 Region: 27-320
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.12e-36
Family Extended AAA-ATPase domain 0.034
Further Details:      
 
Domain Number 2 Region: 333-401
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000165
Family TrmB-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 426368.MmarC7_1030
Sequence length 408
Comment (Methanococcus maripaludis C7)
Sequence
MLDPIEFIHNASSISKKSMNRLKLKTNPFSEKPIRGNTKFFVGRTSELSEIADILGAAQY
GSVANAAIVGTKGIGKSSILNILYYASKRHNHWVVELEASQITARQFLIQLMYGIIKDNL
FSVDGTLSSDYMKHSQKIIEIYKRLSNYSDKTPVHYPREKIERDLKYLLNEVKEENKLCV
ILIDEADQFAKRSCLGLLQFFHSFLYEDDILTFLAGPPTMVEDLTKISPAIRDRIPKIIN
MPPLTKEEAYDLIKRRLEDSQVTGAKGYEPFSEQSIEKIIEECDGIPRRIIMTCSEAVSL
ALKNGVNEINEDIAKNAMKNLGISVGHQILNHLTPAQSKIIKAMAELGGSSTVTELSGIL
NNSTGTIGTHLSDIYEMGYIYKERDGYNVYYTLSKELKDVLITKEDIS
Download sequence
Identical sequences A6VI21
426368.MmarC7_1030 WP_011977410.1.31125 gi|150402954|ref|YP_001330248.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]