SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 436308.Nmar_0393 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  436308.Nmar_0393
Domain Number 1 Region: 33-202,346-448
Classification Level Classification E-value
Superfamily Subtilisin-like 7.99e-80
Family Subtilases 0.00018
Further Details:      
 
Domain Number 2 Region: 227-337
Classification Level Classification E-value
Superfamily PA domain 0.0000000000000353
Family PA domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 436308.Nmar_0393
Sequence length 660
Comment (Nitrosopumilus maritimus SCM1)
Sequence
MGLILTQATDSKNQIHTYLERSVPFVGTDIPRIDGIDGTGIKIAIIDTGVDFNHPDLFGW
GHDGKVVGGYNFIQEGQPPMDNNGHGTQVAGVIAADGQATGVAPKAKILAYKVSEDGEGV
SSDLIIRAIEKAIEDDADIINISLGVNKTNTKIERAVNQALEKEIFVVTAAGNDGPELGS
IGSPGRNFGSVTVGATYNNLTSSLVATLEVNDKPYTVIPMAGNKKTEDAISGKLVFGGFG
KVDELKDLDVKDSILIVERGSDVKEELLYFSIKETNAADAGAKAMIVYNNIPGIFLGELI
HEFIEPNYSPRIPVVSIDREEGLEIIESINGDEATLNLFFNPDYLAHFSSRGPVSPFYIK
PEIVAPGAYINTTQNNAGYNFTSGTSYAAPHVSGAAALLLQKNPELHHHEIKSLLLTTVE
PVSDAYGDEFSIQETGAGRLNIAKAFDAKLIIEPPNFVGLASSDNKVVEKQFQLKSLDGT
WDGFDMTFDGPEFIKFGGELVDENILNVKMRVLEDKFGEHEGKIKISHEGIQYVIPFVLH
YTQGSISIVQQNEKLFFEIHHPEEWSFAKISVTNSKDGRIDTTTVTPDKAASIDVYENAE
YWVDAKIRINGNTSSAYNTIEIKTLEERKRLDFDIPERQMVIIASAVIVIGIIGIVLKRR
Download sequence
Identical sequences A9A590
436308.Nmar_0393 gi|161527901|ref|YP_001581727.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]