SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 438753.AZC_0729 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  438753.AZC_0729
Domain Number 1 Region: 36-464
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.23e-119
Family GABA-aminotransferase-like 0.00000321
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 438753.AZC_0729
Sequence length 467
Comment (Azorhizobium caulinodans ORS 571)
Sequence
MCSGQFRCGGRATFQERTMDQVTDTGALARQLNVDPYWAPFTSNRRFKADPSDRTMISAE
GCYFTNANGVKLFDGSSGLWCTPLGHSHPRIVEAVTKQVRSLDYAPSFQVASATTIQLAE
RVAEMAPEGLNRVFFANSGSEAVDTALKIAMGYHRLTGNATRTRFIGREKGYHGVGFGGM
SVGGIVANRKMFAPGMVNGVDHLPHTYDQSKMAFSKGQPAWGAHLADELERIVALHDAST
IAAVIVEPMQGSAGVIVPPIGYLERLREICTKHGILLIFDEVITGFGRTGWAFAAQRLGV
VPDMITFAKAITNGIIPMGGVIARQEIYEAFMSGPPAAIEFCHGYTYSGHPMAAAAAHAT
LDVYEEEDLFGRVRALEPLMEAEFHSLKGEPNVVDVRNFGLTAAVELSPSAAGPSMRALS
IFEAGLKQGLYMRYTGESLAFSPPFISTEQQIKDMVAILRKLIRDAA
Download sequence
Identical sequences A8IQ13
gi|158422353|ref|YP_001523645.1| 438753.AZC_0729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]