SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 438753.AZC_1155 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  438753.AZC_1155
Domain Number 1 Region: 84-371
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.96e-43
Family Cystathionine synthase-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 438753.AZC_1155
Sequence length 471
Comment (Azorhizobium caulinodans ORS 571)
Sequence
MSSGSSVADVSALRRLPSVDQVLKAGPALAAVERFGRAEATEAVRTALDAARAALRAGTP
APVDAEGIAAAALAALAADARASLCPVFNLTGTVLHTNLGRALLAEEAVEAAVAAMRSAV
ALEYDLDSGKRGERDDHVRDLLCRLTGAEDATVVNNNAAAVLLVLNTLAAGRDSIVSRGE
LIEIGGAFRMPDIMARAGTRLVEVGTTNRTHPKDYRGALSPETGLIVKVHTSNYRIEGFT
AEVPPKELAAIGHEAHVPLFNDLGSGTLADLAAYGLVHEPTVREAVAEGADIVTFSGDKL
LGGPQTGFIVGRRDLIAAINKNPMKRALRVDKIRLAALEATLKLYLDPDRLARRLPTLRL
LTRQPAEMAAVAARVRPVLAAKLGEAFTIEERACKSQIGSGALPLETLASTALALIPADG
SGRRLAALADALRGLPVPVVGRVEDGALLLDLRCLEDEAGFAASLAHLEPA
Download sequence
Identical sequences A8HRA7
WP_012169686.1.27236 438753.AZC_1155 gi|158422779|ref|YP_001524071.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]