SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 439235.Dalk_0144 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  439235.Dalk_0144
Domain Number 1 Region: 233-274,307-335,427-628
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 4.01e-45
Family CoA transferase alpha subunit-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 439235.Dalk_0144
Sequence length 728
Comment (Desulfatibacillum alkenivorans AK 01)
Sequence
MADNQPTFYDDVEKCADDIIRIMGKRVNFAMPLALGKSYHLTNELYRRAKEDPEIQLTFV
TALALEKPTWSSDLEKRLVKPMRERIWKGVPDFDYVLDMRKNALPKNVVVTEFFFKAGSY
NNVPMAQQNHSSSNYTHAIRDITNCFDTLVACQCVCKGEIDGETVYSNSCNSDLAYEIYP
SKLEAERMGKKVIYIGHVNDTLPFMYGDAVEPEHHFDMILDSPKYCFPLFSAPKAPVCTK
DYMIGLHVSSLIKDGGTLQIGIGTLGDAIASGLLMRHHNNGDYNQLLDDLGINNRYSRLI
DKIGGRDEFAQGLYGATEMLVDVFIELYTGGIIKRNVYHNIPLMRMINDGALQEEFTPES
VKELLLQDEHFPILKEQDFISLRNYGIFKDDLRYEDYHLVNGAGKYSVDFRDSANLDAVL
ENCLGDRLKNGVVLTGSFFIGPNGFYDFLRDMSDEERKKFEMTGVKVVNQLYGDEVLRSL
ERKDARFVNAGMKISLMGNVASDALRNGTVISGVGGQYNFVSMAHALPDARLIMMLRSTK
ETPKEVKSNILFNYGYTTIPRHLRDIVVTEYGIADLRSKQDWVVMTELIKVADSRFQDEL
LDEAKKAGKVPMDYEIPYEYRNNYPDQLEKKLAPFKAKGYFKPFPFGKEFTDEEVALGAS
LRKFKGGMTANKFKASKALIKDFKAPVPPEATPYLKRMNLDAPKGVKEKLMQKLVVHALS
NAGYVKLQ
Download sequence
Identical sequences B8FMI7
WP_012609294.1.12191 WP_012609294.1.94734 gi|218778004|ref|YP_002429322.1| 439235.Dalk_0144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]