SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 439386.YG5714_0299 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  439386.YG5714_0299
Domain Number 1 Region: 1-261
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 2.69e-67
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000145
Further Details:      
 
Domain Number 2 Region: 252-462
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 1.65e-56
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 439386.YG5714_0299
Sequence length 463
Comment (Sulfolobus islandicus Y G 57 14)
Sequence
MRSKEDFLKSLKDGRNLYYRGKLVEDITTHQILKTAALHAAKLYEYADRVYEDNKMGKMS
KFFKVPWTSQDLLDRHKLIYDLTMYCNGVFNISQAIGSDAIFALMITAKQVDRKYGTDYS
KRVEKYFERVAKEDLTLATAQTDVKGDRSKRPSEQVDPDMYVRVVDVKSDGIVVRGAKAH
TTQSAVSDEIIVIPTRVMRDSDKDYAVAFAVPANTKGLKMYIRPIDEIEGNSSSVLSRKD
YELETLTVFNDVFVPWDRVFLFKEYDYAGTLAMLFATFHRFTALSYRSATMNLYLGASKV
ASQVNGIENEKHVRDDIVDIILYKEIMRSSAIAAAVYPVNMEGIAVPNPLFTNVGKLYSN
MHFHDVVRDLIDIAGGIIATMPSQEDLESDEGKNIVKYLRGSVDGEERAKVLKLAKELGA
STFTGYLLTGMIHAEGSMEASKIELFRSYNFKEAENLVKRVLS
Download sequence
Identical sequences C3MKV0 C3N9C8 C3NMZ6 D2PFC4 F0NE56 F0NJ81 M9U6P9 Q97VV3
WP_010923905.1.13477 WP_010923905.1.27011 WP_010923905.1.34992 WP_010923905.1.52267 WP_010923905.1.66823 WP_010923905.1.67233 WP_010923905.1.8449 WP_010923905.1.91160 273057.SSO2503 419942.YN1551_2902 429572.LS215_0322 439386.YG5714_0299 gi|229583326|ref|YP_002841725.1| gi|227829341|ref|YP_002831120.1| gi|479324713|ref|YP_007864761.1| gi|15899242|ref|NP_343847.1| gi|229578114|ref|YP_002836512.1| 356179 gi|284996700|ref|YP_003418467.1| gi|385775038|ref|YP_005647606.1| gi|385772320|ref|YP_005644886.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]