SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 441620.Mpop_1299 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  441620.Mpop_1299
Domain Number 1 Region: 3-188
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.96e-49
Family Methylesterase CheB, C-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 441620.Mpop_1299
Sequence length 354
Comment (Methylobacterium populi BJ001)
Sequence
MNNRDVIVIGGSSGATVPLKTILGTLPRDLPAAVFVVLHIPARSLGLLATVTAAAAHLPV
LPAADGMPIEAGTIYLGVPDHHLILEEGRIRLGRGPRENMARPSIDPLFRSAAASYGPRV
IGVLLSGLLNDGVSGLGAIKSCGGLTLVQDPAEAIAAEMPRSALSALEVDLTLSAARIGD
VLSELVRDAPGPRLPVPPEIRLEVDIAAGERVDSDVLRRFADPVAMSCPHCGGVLSEVRD
GKPLRFRCQVGHAYTAEAVAKQQEGAIDEALRVALRIIEERAELVRRMAEDGRKAGRPTV
SEMYEERAAEYRRYGDVIRRAVLQTLPTPEPSSEAEPSPESFPPSSGGEGGQEG
Download sequence
Identical sequences A0A177I2A7 B1ZCV8
441620.Mpop_1299 WP_012453219.1.72001 WP_012453219.1.78039 gi|188580560|ref|YP_001924005.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]