SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 442563.BLA_0244 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  442563.BLA_0244
Domain Number 1 Region: 703-797
Classification Level Classification E-value
Superfamily TPR-like 0.00000021
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 
Weak hits

Sequence:  442563.BLA_0244
Domain Number - Region: 612-695
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.068
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 442563.BLA_0244
Sequence length 912
Comment (Bifidobacterium animalis lactis AD011)
Sequence
MQEPLGNPYQNPESTQSAQSAAGLGTDPFSPVTPVSVGGQGQSAPTNQSVQTYQLPFLAK
VSRLAPIPGDPTNSRYGIVMRLKDVSQPQNGLGYIVRFADDPATGKQNNKQVQIIAWISK
SLKVYPTTVPLTNDPSTNDVEGELHFDAWTDQKNLGAVRIQSNDGLNRTITIGELQLDFS
GSGYSTGSLNGIATASSVDLGPYGPAATNSAAPAHATNTGSARHPLNSLLAAFWLAAAHF
PKLRGEQLGMGAGRIVEIFQNMQNKPLADALDEIIWRGTTNSNTASPFERFAARQLIEAG
AGQIREITAEHNLDVVQLDSTGQFWMRFNRNEITGLQRDIVLSVEGALNRLAAASRIAAK
YDNGMGLVTTLTEAQDYRAGFDELHEWDTHTSFIQSRADARNSNLTVRGATAARGGMWDV
MSRFVDICERLILPYRVEYRCDANPDTGEMVVNFTVPTSLMMPASVLTDSGWVGIREQRA
AQAASYALRLAGIIAQAAFTAGTNITSLTVNGTLGSVTGAPVLSLAFTRTPFMMGTVPAF
MAGQFNDPALDSDPAAVLQMLRPSAQVISFGPDRGLTPITALPIPQAILAHRVPLWRDDR
ELPDDLKALLGADFGRDLDVMYDGASIKGGEIFQIAEQNEDSPMSASLEIESALMGLQSE
MPDLGERKPLYCEHPLMRLLVANLPDHTPQTRYVKAPDALYNSHIALARIHRDSGDLDGS
LAQLQQALALAPTTAQPFVDESITYVDIAGDHAKGADVLTRGLAVAVMPGDVNFMYYRLA
YSLWQTNNREAALACYAFMLGMGFHAQYEEAAEVEVRELMQEMGVDSLPDMDAVTHTLNK
HGIPVAPLTSQTELLAKAAIRLVDAGFPLAADEAVWALGALSNDDRLGALRQSLRFGVLD
EDAVLASERPAN
Download sequence
Identical sequences B8DVP5
gi|219682739|ref|YP_002469122.1| 442563.BLA_0244 gi|452892181|ref|YP_005579062.2| gi|518656708|ref|YP_008143070.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]