SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 444157.Tneu_1178 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  444157.Tneu_1178
Domain Number 1 Region: 18-416
Classification Level Classification E-value
Superfamily ADC synthase 1.27e-121
Family ADC synthase 0.0000000698
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 444157.Tneu_1178
Sequence length 422
Comment (Thermoproteus neutrophilus V24Sta)
Sequence
MKIPLSKLPPPRDLAHGLYQSGEEFVALLESGQGFAERARFTLVAWGVERAYVSSGPDLQ
QVLYSAQRELRADGGPFGGDVLIGALTYEASYYVEPLLLRYNKVDRSIPAAFLVKPRGYI
LYDKMLGRGYLRGEMPRVSVGRGEARVRGPVAMTDPGRFKSWVAEGRERIAAGEILQVVL
SRWVDYRAEGDLFPLYKALAEGNPSPYMYFVKYGDIHLIGTSPELLVKVQGGRVETHPIA
GTRPRGATEEEDLALEEDMLSDEKELAEHIMLVDLARNDIGRVCQLGSVKVEELFAVEKY
SRVQHIVSRVMGVMDRRFTPVDALLATHPAGTVSGAPKVRAMEIIAELEDEPRRFYAGAV
GFMSPSLLEFAIVIRTMVAVGDSLRIQAGAGVVYDSTPEREFRETESKLAALKAVVEGGP
WT
Download sequence
Identical sequences B1Y8M8
gi|171185634|ref|YP_001794553.1| 444157.Tneu_1178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]