SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 446462.Amir_2357 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  446462.Amir_2357
Domain Number 1 Region: 158-455
Classification Level Classification E-value
Superfamily Phase 1 flagellin 4.45e-19
Family Phase 1 flagellin 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 446462.Amir_2357
Sequence length 459
Comment (Actinosynnema mirum DSM 43827)
Sequence
MSSTFSGITSALGGMQAARRGLEVAGQNIANARTEGYSRQRVETAAVGGTANAAFYATPP
ATAGSVEVTGITRMADAFLEARGRTEHSKQAYLDGREEILATTEGLFDEPSDNGLQAQLT
GMWKSWTDTADNPGDSAVRNQLVVSSGVVADRLNNLAQTLGGEYNDTRGRLDSTLSEINT
GARRLADLNTAVVQAKQHGLPANELLDQRDQLALRLVELTGGTTSTGADGSLDVQLGGVS
LVSGSTARSLTLTGSATLTGAAGDPATVRWSDDASAAPLTGGSGGALLEGLTTIMPDYLA
QLDQVASKLATGVNQQHKAGFTPTGAAGGDFFSGTTAATIKVALTSGDQVATSSSATRAL
DGSNADAISALARSATGPDASYRQTVVKIGMAVQTAASRSATQASITAQVDAARQSSAGV
NLDEELTSMLTYQRSYEAAARVMSAVDSMLDTLINRTGR
Download sequence
Identical sequences C6WJS2
446462.Amir_2357 gi|256376483|ref|YP_003100143.1| WP_015801186.1.52053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]