SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 446462.Amir_4465 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  446462.Amir_4465
Domain Number 1 Region: 457-595
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 5.11e-31
Family Aromatic dioxygenase reductase-like 0.077
Further Details:      
 
Domain Number 2 Region: 372-468
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.15e-26
Family Ferredoxin reductase FAD-binding domain-like 0.002
Further Details:      
 
Domain Number 3 Region: 587-696
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.44e-22
Family 2Fe-2S ferredoxin-related 0.013
Further Details:      
 
Domain Number 4 Region: 161-277
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.00000000000174
Family PNP-oxidase like 0.02
Further Details:      
 
Weak hits

Sequence:  446462.Amir_4465
Domain Number - Region: 24-152
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.0012
Family PNP-oxidase like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 446462.Amir_4465
Sequence length 699
Comment (Actinosynnema mirum DSM 43827)
Sequence
MTSTTPHRLATVAQVEAVIGRAPAPVLAKQITALDEGCRAVLARCPLAAFGHRDADGVQR
TTFVGGAPGFARVHSPTRISFPLPGARPRGPVSFTFLLPGVGETLRLNGKTAGRAGDEQL
VDVLEAYVHCAQAVIRSDLWQPPVPADPAPRPEGAGPLSAPEVADFLAAARFLALSTEDG
DGGSDTSPRGDLGGAAHPLDARTLAIPDRRGNKRADTLHNLVRDDRVSFAALVPGRTDVL
HVSGRASITTDPDLLEPLALRGIPPHAALLVAVEHAEVTPNAALTHSRAWSPQAHARQGE
VPDLMVLAGDHLAANLAARKGFVPRLLAVFTRIPGLGAFLRLVINRSYRANLREEGYGDV
RLTPACAEPPPHEVEITEVRGETPDAVTLVLTSERPFDFHPGQFFTLLADLDGEPVRRSY
SASSAPGGTTLELTVKRVPDGRFSTHATTALRAGDRLALRGPSGAFHLNPTETREVVLLA
AGSGITPLMSMIRALLATDAPARISLLRTDRTAQDEIFADELTTLARHNPDRLTVTSART
AEQGRLDATRVGAWLTTTAPSERAHYYACGPDPLVALFRELLTTRGVPPEHVHHERYTTA
APTRVAAPQPLLVVDGARTLGSTVVEPGQTLLDAALAAGLPMPHSCTVGSCGDCAVALRA
GEVTMTEPNCLPPARRAAGEVLTCVGCPLSPVTVDVSAR
Download sequence
Identical sequences C6WK98
gi|256378497|ref|YP_003102157.1| WP_015803198.1.52053 446462.Amir_4465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]