SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 446465.Bfae_01320 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  446465.Bfae_01320
Domain Number 1 Region: 98-313
Classification Level Classification E-value
Superfamily MetI-like 0.0000000000000152
Family MetI-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 446465.Bfae_01320
Sequence length 328
Comment (Brachybacterium faecium DSM 4810)
Sequence
MHLLRKIGFYLVALWAAVTLNFFIPRALPGSPVDAVLAKLALRGPVDPHTREAIEVMLGA
DNDRSLIQEYFAYLGGLFTGDLGVSVTYFPTPVSAVVGQSLPWTLILVGLATTFTFLLGM
VLGTVAGWRRGTWLDSLIPATTILQAVPYFWLALLFIYVLSVNLGVFPISGGYDYTLVRP
AFDYPFLSNAVYYGFLPALTIVLSSLGGWLLGMRNMMVSTLSEDYILTAEAKGLSPRRVM
IMYAARNAMLPSVSGFAISLGFVVSGSIVVETVFSYPGVGFTMLQAVQNNDYPLMQGMFL
IITVSVLAANLVVDLLYGVIDPRTRARG
Download sequence
Identical sequences C7MFB3
446465.Bfae_01320 gi|257067348|ref|YP_003153603.1| YP_003153603.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]