SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 446465.Bfae_04530 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  446465.Bfae_04530
Domain Number 1 Region: 14-153,203-232,335-452
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.15e-46
Family FAD-linked reductases, N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 446465.Bfae_04530
Sequence length 457
Comment (Brachybacterium faecium DSM 4810)
Sequence
MSELPGAAAEQGRCEVLIVGGGPTGLFLAALLARRGVDVVVLERRAVPSRHSRAIGLHPP
ALRALRELGLQRAASEAGVRLDRGSALAGDRPLGEVRFGGRRTASPYVLSLPQTRTEELL
TQRLGALAPQALHRGWTVTAVEEHPSGVEVTARRTDAVPATAPEHTDPAGADGSDHPVRS
VPSLDSPDDAGRQRAERRALGEEEGAPGRWRAELVVVADGSRSGTRTRLGIPMRGRGYRD
SYLMGDFADAGRGPRRARIHLERGGVVESFPMPEGRRRWVVHTGCTGTASRRGAVPRPAS
APRLTSLVKERLGAGPDPETATMLSAFTVAQRRAARLCTARCMLVGDAAHEVSPIGGQGM
TLGWLDALEVAPLIVRVLRSRPIMDFATAPEWARVERRILRRARWAGWIAGVNTVLGRPA
PGVLCGVRAAALVVVLRSPARTLLAWLYSMGWTDLQR
Download sequence
Identical sequences C7MHB4
gi|257067658|ref|YP_003153913.1| 446465.Bfae_04530 YP_003153913.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]