SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 446465.Bfae_05450 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  446465.Bfae_05450
Domain Number 1 Region: 578-776
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.14e-24
Family Extended AAA-ATPase domain 0.015
Further Details:      
 
Weak hits

Sequence:  446465.Bfae_05450
Domain Number - Region: 287-338
Classification Level Classification E-value
Superfamily Methylated DNA-protein cysteine methyltransferase, C-terminal domain 0.012
Family Methylated DNA-protein cysteine methyltransferase, C-terminal domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 446465.Bfae_05450
Sequence length 853
Comment (Brachybacterium faecium DSM 4810)
Sequence
MSTMWGIHNDQIPAAELLAGQFVSIGWNEIDDVREIGNDQTALKAALAAANPDAKPGALP
VWAGVLRRFAFEMSEGDLVVAPSKQAPVFNIGRIAGPYEHHPEVPEHRHRRPVEWLVTDV
PRTAFTQSALYEMGAVMTLFRVTKHAEEFERVVENGVPAVAAAPERRTRVRHGLLQRTVL
EVLRDRGSTPRHEIIKDVATRIELTGYETSRTAKGIPRFEVSITWGSVDMVAAGWILKTK
RGWILTREGRDVLSKSTEADDLSKISGAAYKELRAAKRAQVGRFKTDRYPLIDEAVKLLE
EGQWTTYSDIAAVVGSNPPSVGEYLLNRAIGIDGRYRVVPVGQPPYRDEDRAALEAEGVS
FDDRGLPDPLKKVSTEDLRESMDLLGLLPGVPRRAWMVRGSSVAGQDLVPAWLDDGEVTL
LTSRLRPVQFGASRDELKPIIDEDYAHASYDVRVEKMDDAHAFLTRMQEGHLVVTVDDGR
VFVGTILEAARQRATTAGSSELVRDVEWADPGGVALSEISSTLSTRLKVQRDIVDLTQQI
DLIEDLLDAEEENVPPAIVERAPLREASPELAEDLHVPQAWLQECIDLLDDRPQLIFYGP
PGTGKTFLAQAIAKHIAGENVRLVQFHPAYSYEDFFEGYRPQEGGGFTLKPGPLRKVVSQ
AKENPQDAHVLIIDEINRGNLAKVFGELYFLLEYRTENVELLYADEEFNLPENVFIIGTM
NTADRSIALVDAAMRRRFSFLPLHPSEEPTNRILRSWLSAEGRPRRVADLLDELNRRIDD
PDFKIGPSYFMRSAVHREGGLERTWRTSILPLLEEHHFGEMDARAVRTRYGLEAVSAAVD
RTEDPTDAPSRTH
Download sequence
Identical sequences C7MHK2
gi|257067746|ref|YP_003154001.1| YP_003154001.1.138 446465.Bfae_05450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]