SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 446465.Bfae_20640 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  446465.Bfae_20640
Domain Number 1 Region: 346-513
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.96e-41
Family Histidine kinase 0.002
Further Details:      
 
Domain Number 2 Region: 272-356
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 5.3e-16
Family Homodimeric domain of signal transducing histidine kinase 0.002
Further Details:      
 
Domain Number 3 Region: 229-279
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000000105
Family HAMP domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 446465.Bfae_20640
Sequence length 572
Comment (Brachybacterium faecium DSM 4810)
Sequence
MTSSLDGVAAASRSVGRVLDVDPRSWPLALRVVLVTTLLSIVALLAVGAYLSSVIADGLY
EQRRDRVLEETLEVRSDLIDSLSQVSGATSTQQQDEVNAFVQTAGGQGGGDRREAALIPV
ETSGNVFPVASSDQTLFDELDADLTDAVAADPDAVAWRSIGREDASGTIAPALLVGTRVI
VPGSGSYDLYLVYSMQEEQETLAFVQRVILGGGAVLLALIVGIAIVVARMVTTPLKRAAH
AAERMAAGDLTSRVEVAGADELAKVGESFNDMARSLEQKVDDLTELSHVQQRFVSDVSHE
LRTPLTTIRMASSVLDARREELPGELQRTAELLAAQVQRFEVLLADLLEISRFDAGAAEL
TAHREDIDALVERALEDVRPLAGMRGCQLDVHLSGRDMEAVVDARRIDRILRNLLTNAIE
HGAGRPVLVQTAADADAVAVVVQDHGHGISPEAAERVFDRFWRADPSRARTLGGTGLGLS
ISAEDARLHDGWLQAWGQEGEGAVFRLTLPRRPGPVLVRSPLLLERSFDRDEPEAAVSPT
PTGELRISPELLPDMDEQTSVPVTDPGEGGAR
Download sequence
Identical sequences C7ME64
gi|257069206|ref|YP_003155461.1| 446465.Bfae_20640 YP_003155461.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]