SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 446465.Bfae_29400 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  446465.Bfae_29400
Domain Number 1 Region: 36-301
Classification Level Classification E-value
Superfamily MetI-like 6.28e-70
Family MetI-like 0.00006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 446465.Bfae_29400
Sequence length 305
Comment (Brachybacterium faecium DSM 4810)
Sequence
MTAAANPITPTRPAEAAAAHVATPTPSRRRRKLDPFRVLAFVILAVLALAWLVPVAWAVL
TSLKTEAEAAAMPVTLVPDSGFTLSAYKETLSEGKVPRWAWNSLLTSSLVTAITVVISAL
AGYALSRMTFTGRRLIITLTVASIMIPSQILIVPLFKLMLSLDLVDTYWGIILPQVVAAP
MVFILMKFFDQIPKELEEAALMDGASRLRILWSIIVPLSRPILGAVAIFVFIGAWNNFLW
PFIVINDADLMTLPVGLQTVISAYGIQYAQNMAQAVLAALPLIVVFLFFQRQIIKGISTT
GIAGT
Download sequence
Identical sequences A0A1X6XCA2 C7MA31
446465.Bfae_29400 gi|257070036|ref|YP_003156291.1| YP_003156291.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]