SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 446465.Bfae_30030 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  446465.Bfae_30030
Domain Number 1 Region: 11-194
Classification Level Classification E-value
Superfamily MetI-like 9.94e-20
Family MetI-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 446465.Bfae_30030
Sequence length 216
Comment (Brachybacterium faecium DSM 4810)
Sequence
MTWVRENLDVIAAYTGAHLLQALPPILVAFALSLPLAKLANSRGWLRTGVTTTSGLMYAI
PSLPLFVLLPGLVGTGVRSPLNIAVALSLYGLALMVPTASDAFRSVSRDVLGSATAQGYA
PAARFLRVELPLAGPVLLAGVRVVAVSTISLVTVGGVLGVPSLGMLFVDGVRRGIVEEIA
AGIVATAALALLTDALLVLLGRAVMPWTRQPEVRRP
Download sequence
Identical sequences A0A1X6XH87 C7MA94
gi|257070099|ref|YP_003156354.1| YP_003156354.1.138 446465.Bfae_30030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]