SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 448385.sce2549 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  448385.sce2549
Domain Number 1 Region: 5-107
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 6.98e-24
Family Frataxin-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 448385.sce2549
Sequence length 112
Comment (Sorangium cellulosum So ce 56 )
Sequence
MSGEPLSEREFDDVADRSLRALDRAINEIPDGVEADLQSGILTLEFEDGIKYVVNSHRAA
RQIWMAAERAAWHFDYRPSEDRWVAQKSGEELWSTLEAVLSRKLGRAVKLAR
Download sequence
Identical sequences A9G6L2
448385.sce2549 gi|162450821|ref|YP_001613188.1| WP_012235181.1.90317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]