SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 448385.sce6351 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  448385.sce6351
Domain Number 1 Region: 5-265
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-51
Family Protein kinases, catalytic subunit 0.0000893
Further Details:      
 
Domain Number 2 Region: 1310-1490
Classification Level Classification E-value
Superfamily GAF domain-like 6.98e-28
Family GAF domain 0.0048
Further Details:      
 
Domain Number 3 Region: 292-495
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000095
Family Nucleotide and nucleoside kinases 0.062
Further Details:      
 
Domain Number 4 Region: 1558-1646
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000314
Family Anti-sigma factor antagonist SpoIIaa 0.0048
Further Details:      
 
Weak hits

Sequence:  448385.sce6351
Domain Number - Region: 743-849,1099-1219
Classification Level Classification E-value
Superfamily TPR-like 0.00316
Family Tetratricopeptide repeat (TPR) 0.069
Further Details:      
 
Domain Number - Region: 1004-1055
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.0392
Family HEPN domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 448385.sce6351
Sequence length 1675
Comment (Sorangium cellulosum So ce 56 )
Sequence
MAEQGAYTFTAKLHEGAGVVIHRAVRARDGARVVVKIGKGGPLAPAIHGALRREFAVLRS
LDLPGVIKAHALDTIGDELALVLEDCDGRSLDVLFHAGALDLAAVLAIGVEVAGTLDLLH
RYPLLHRDVKPHNIVYNPATGQVKLIDFSLAIAGGEDEASRGDAGAGMAGTLAYMSPEQT
GRMNRPVDARSDLYSLGVTLYELVTGVLPFEAADAMALVHSQLARVPVAPAALMPKVPPV
LSDIIMKLLAKAAEDRYQSAAGLRADLQRCAAAWAATGTIEPFALGSADRPSTPRIPPRL
YGRQREIDVLLATSARVADGARTLLLVSGPGGAGKSALVQTLAAPVARGGGFFVAAKCDQ
YDRGAPYAPIATALRELCRTLLTAAPEVLEAWRRALASALGSSGKLLTDLIPELELIVGP
QPEVPRLGPAESQNRFNLIFTALLRVFAAAEHPLVLVFDDLQWVDPASLRLLQEMLLDAE
CRYLLVLGTYRDDDVGPGHPLPAALADLRAAGVEVGDVPLGPLALADVEELLADTLVMER
PQVAALARIVGEKTHCNPFFIGQFLLLLVEDGLLRWDPAACRWAWDDAQVQARDVTDNVV
TLVTSKIRRLTPAAQRLLQRAACVGYRFSWRVLAAVGSDDGDDATAALGELVREGLVVPL
AGGEGDDLHRFLHDRVQQAADSLLASEVREATHLRVGRLLRDAYPAGVPDEALFEVVGHL
DVALPRIDGDERLELSRLNLRAGRRARAATAYHAARQYFQAGCECLGADPWARWFELGFA
LRVELAECAYLCGAFAEADALFEEALARARSREERAQVYDLRVLLHAAMGDFAAVVAAGR
AALAMYGIGLPDEGPALQEAVAAAFAAAHEHLGERRIGALLDAPPARDPDVEVVMRLLAS
MSGPVFVGRPALFPLIVLHMVNLSLRHGNVDGSDYSYAVYSILLAGVTGELGKAYEFGEL
GVKLNERTGNLRTRCMVHFLFGTSVVFYRQPYAAGEEYRDSARRVALEVGNFAYVSFYCL
QSAALALIADADIRGAEARIDDVTALLRKTRDVASTAVVEFMRRVVVNLMGEPATSALGG
DGFDEDAFVAHMPPGGLVPWLYAVSKLRLAYLYGEHERGLELAARARELHESGAGAGHMY
SPEQYSYSGLVAAARWDAAGEAEREALARQLDREREALRPWSTSNPSQFVALQHLLDAEA
ARLAGRDAEAIAGYEQAIAEAQARGFVLHAALASECAARLHLRRNRRALAGAYLQDAHVG
FARWGAAAKASQLLLTRADLLAPPAPARAGHSTGRSTTTSRRHGGGSLDLEGLMHAAQAV
AGELVLDRLLDRLMRIVMLRAGAQRGFLLVPQGEDLSIAAEMRTAPDEVRVGLDQPMRDD
AALATSVVRFVARSREGVLLGDAGAEPRFARDPYVASQRPRSVLCLPLLLQGRLSGILYV
ENNATRDAFAPERVELLQLLSAQAAVAIENARLYASVQQAREQLEQQVEARTHELQTALE
QLQAVNADLVRKGEALREAHAQTRREIGERERAERERSAAQAEILRVQEERLADMAAPLL
PITESIVVMPLIGVLDDARASQVLATALEGSVRTRARVVILDITGVRQLDAAPAAILVRA
ASALRLVGAQAILTGVRPAAAQLLVRDAAGLDGLLTLGTLQSGMAYALAHTRGRG
Download sequence
Identical sequences A9GK18
gi|162454631|ref|YP_001616998.1| WP_012238967.1.90317 448385.sce6351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]