SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 449447.MAE_08010 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  449447.MAE_08010
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily L21p-like 5.89e-36
Family Ribosomal protein L21p 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 449447.MAE_08010
Sequence length 129
Comment (Microcystis aeruginosa NIES 843)
Sequence
MSYAIIETGGKQIRVEPGRYYDIELLPVDEQSTHTIDKVLLIHDEDDISIGQPFIEGATV
EGTVIQHRRGKKVIVYKMRPKKKTRKKRGHRQEITRFMIDSINYNGKTLVATAATSSAEV
VEDSSDEEE
Download sequence
Identical sequences A0A139GQU5 A0A1V4BY04 B0JQG4 I4FPV1
gi|166363542|ref|YP_001655815.1| WP_002760284.1.24258 WP_002760284.1.4043 WP_002760284.1.52201 WP_002760284.1.79847 449447.MAE_08010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]