SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 449447.MAE_28680 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  449447.MAE_28680
Domain Number 1 Region: 1-189
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 9.15e-45
Family Protein prenylyltransferase 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 449447.MAE_28680
Sequence length 220
Comment (Microcystis aeruginosa NIES 843)
Sequence
MYEEAAQSYANAAQVKDDNYWAWYDQGCVYLQELKDYEKAIACFQRALSHSPGDYWAAYR
QGEAYRLLKNYERAITFYDLALGARPRDYWAWYRRGDAFRDWGNPQEALFNYRTALDIRP
QDYWSWYQQGVILQELQRLPEAIACYEESLKIDQDDRYAWYNAACCYAALGQQEKAIDCL
REALDIEPDICGELVRNNFVFDGLRQNETFNDLLSCYSPG
Download sequence
Identical sequences B0JJP8
gi|166365609|ref|YP_001657882.1| 449447.MAE_28680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]