SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 449447.MAE_36750 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  449447.MAE_36750
Domain Number 1 Region: 359-539
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.9e-43
Family Pyruvate oxidase and decarboxylase PP module 0.0000815
Further Details:      
 
Domain Number 2 Region: 1-175
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.38e-42
Family Pyruvate oxidase and decarboxylase Pyr module 0.00003
Further Details:      
 
Domain Number 3 Region: 161-334
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.31e-34
Family Pyruvate oxidase and decarboxylase, middle domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 449447.MAE_36750
Sequence length 547
Comment (Microcystis aeruginosa NIES 843)
Sequence
MITIGEYLCQRLHNLGVNHVFGVPGDYVLDLMDVLVESPIELVCTCNELNAGYAADAYAR
VKGMGAVCVTYGVGGFSLVNAVVGAYAERVPLVVISGASDRSIRRDNLLLHHTTGDYNLQ
LSIMEKVTVASVILTNSAQAASQIDQTLAACLHHKRPVYIEIPRDLVYRPCIPSEKPIYL
TDNLTDAAALEEAIEEAAFLLEKAEKPIILAGVEFHRFKLQDKLLKLLEVTGYPLATTIL
GKSSISEMQPQFIGTYVGALSREYVSQRVENADCVLCLGAIMSDMNLGGFTANLNPNNLI
NANSEKIKIKHHFYQPVFLGDFIEGLINKLSHKEAATLEIKPAVELKNLEFIPVPEQKLT
NARFYERMNHFIAQESFVISDTGDAIIATIDLLMPQKTDFIGQAFYLSIGYSIPACLGVA
FAAPNTRPIVFVGDGAFQMTAQELSTIIRHHLNPIIFLINNDGYTIERVIQDNIYNDLQP
WKYHQLPAVFNGESWSCQVGTEGELEKALSIAQGNIDRLSFIEVHLDRFDCSQGLTRLGQ
ALRSPHA
Download sequence
Identical sequences B0JNR7 I4HQU4
449447.MAE_36750 gi|166366416|ref|YP_001658689.1| WP_002796891.1.4043 WP_002796891.1.50331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]