SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 449447.MAE_53730 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  449447.MAE_53730
Domain Number 1 Region: 221-357
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 4.32e-23
Family Pentapeptide repeats 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 449447.MAE_53730
Sequence length 403
Comment (Microcystis aeruginosa NIES 843)
Sequence
MKASEVLDLYAKGKRNFKGVKLKGQCFQGKNLSGANFSQADLRGTNFQGAILEGTKFTEA
RAGLLKRGRLQLILISWLIAAICGCLWGLAGYYLALMLVTDVTEFKIIGAVIITILSLIY
GIFYRQRVGGLPLVLSLISGQKISFILAIFISLILTLLIVIILAFQGALAGIAVMNVTFS
IALIVGVCVTLFTAYLAWLSLEESRETITKFMAIAFLASKGTNFCGANLQEADFTGAQLK
ATDLRAKDLTRTRFYLVSGIERARWEKTILDEVAMRNLLVTGQGENKAYIGYNFRGLNLY
GFNFKNANLTRANFSEANLAYANLEGANLAHSNVMRANLQGATLTGACIEAWKIAENTNL
EGVDCDYIYLVECDRERRPREGEFGEGEFRQLALEQRKLYIDE
Download sequence
Identical sequences B0JYF7
gi|166368114|ref|YP_001660387.1| 449447.MAE_53730 WP_012267717.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]