SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 452637.Oter_2454 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  452637.Oter_2454
Domain Number 1 Region: 447-553
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.91e-17
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 452637.Oter_2454
Sequence length 606
Comment (Opitutus terrae PB90 1)
Sequence
MSEEGSSSYFAFRPKLMDCLRGYSRDRFMSDLAAGITVGVVALPLAMAFAIASGVPPQAG
IFTAVVAGFIISALGGTRVNIGGPTGAFIVILYGIYAKYGAENLAICTIMAGVILFLMGF
ARLGSMIKFIPYPVTMGFTSGIAVLIFSTQIKDFLGLSVEKVPSEFMEKMMVLGEHLGTT
QWPTLVLALASLAIIIFWPKGWQRRVPGSIVALVVGTVAAMLLKLPVETIGSRFGDIPQA
LPAIQFPTIEWANLRNLIQPATTIALLAAIESLLCAVVADGMIDDRHDSNQELMAQGLAN
IAAPLFGGIAATGAIARTATNVKSGGRTPIAGIIHAITLLGIILVAAPLAKFIPLATLSA
VLVNVALNMGEWHNFARLPKWPRSDALVFLTAFGLTVIIDLTVAVEIGMVLAAVLFIKRV
SETSQITAVDEATETEGSHHSLVGKQIPERVMIYRMFGAFFFGAADKLESALRREKQEPD
VLILRMRKVMAIDATGLNALEDLYERLRRKGKSLVLSAPHTQPMFVMENAGFLERIGREN
VCPHIDAALERAREILGLPPVAMPKDPLEDERRRLQQARQELSSAIERADQALNPDGKPS
DEQAKK
Download sequence
Identical sequences B1ZSD7
WP_012375271.1.87878 452637.Oter_2454 gi|182414270|ref|YP_001819336.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]