SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 453591.Igni_0542 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  453591.Igni_0542
Domain Number 1 Region: 180-540
Classification Level Classification E-value
Superfamily HydB/Nqo4-like 8.37e-97
Family Nqo4-like 0.00000206
Further Details:      
 
Domain Number 2 Region: 10-185
Classification Level Classification E-value
Superfamily Nqo5-like 6.02e-33
Family Nqo5-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 453591.Igni_0542
Sequence length 540
Comment (Ignicoccus hospitalis KIN4 I)
Sequence
MNFVGEVERKEWSNALYVEVEPQYWYENAARLKDQGYLFPSMLTAVDWPAEKKVQVFFLV
HRIRDASSVVLSTKVDRENRELPSLSSLYPGVEWHENETYEMFGINFTGHPDYERWGRIR
KLLLSEDPRLFPKDRFPLLKDSGGYKDLPKVNWAEIEGTDQEREGLREDLTYVYVGPQHP
ATHGPVGFLLGLKGEIVEDVIPRLGYVHRGVEWIYEQKEYLKVIPLLDRQCYIDGIGWEW
PYVMALEEIMDVKVDRRAQLLRILAAELSRIQSHLLYIGSFAENVNHLTAFAWTVRDREV
FINLLEMLTGQRMTFNYLRPGGVAFDLPQGFKDVYEKVVARFHKHFEKLIETTLDNPTVA
MRAEGVAQVSAEDAIKYGWSGPNLRASGVAWDLRINKPYGGYDDGIDFEGAVGSVGDNLD
RMLVRFEEIRQSLKIIRQVLRELTERGQNELGTHLKRVPPFPRKPGIAYGYHDSPRGENG
ILLVANPSDPKWRTRPWRVHMRSPVFVHTMSLKYLGKGLLLQDFLAFYISLDTCVAEMDR
Download sequence
Identical sequences A8A9X2
gi|156937335|ref|YP_001435131.1| 453591.Igni_0542 WP_011998576.1.33635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]