SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 455488.A2cp1_1273 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  455488.A2cp1_1273
Domain Number 1 Region: 56-277
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.22e-33
Family GpdQ-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 455488.A2cp1_1273
Sequence length 282
Comment (Anaeromyxobacter dehalogenans 2CP 1)
Sequence
MDRFGRRQFLKGAALLGAAGAAGLVPAASSAAEPRLPDTDPVTFEVPGLDPAHDGLRIAQ
LSDLHVGPRTPSATVRAAIEDANAFAPDLVVLTGDYLSHSRRELAAMRDLLGGLVAPTIA
VLGNHDVWVDPDGAAGALKGHGYEVLENGWTSIRLRGAPLHVVGVGDHLTRRDDVQRAVK
GLPAGAAPLVLAHGPRTADKLRHLERPMVCLSGHTHGGQINIPILTPLFLASVAREPYVR
GRYQLGAVQLYVNRGIGMSGIRVRVNASPEVTLATLRRAEPA
Download sequence
Identical sequences B4UHK2 B8JGE6
gi|220916379|ref|YP_002491683.1| gi|197121615|ref|YP_002133566.1| 447217.AnaeK_1204 455488.A2cp1_1273 WP_012525262.1.49349 WP_012525262.1.98204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]