SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 455632.SGR_6104 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  455632.SGR_6104
Domain Number 1 Region: 54-322,382-420
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.74e-84
Family Type II chitinase 0.0000029
Further Details:      
 
Domain Number 2 Region: 324-383
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000000000198
Family Chitinase insertion domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 455632.SGR_6104
Sequence length 423
Comment (Streptomyces griseus NBRC 13350)
Sequence
MFKPHRPRARLRALAAAACTAALGATLLGVAGTSPAGATPVAQPAAAPAAAEAAPTAAGD
KVIGYFTNWGTYDRNYHVKNIETSGSADKLTHINYAFGNVTGGKCTVGDAYADYEKAYTA
DQSVDGVADTWDQPLRGNFNQLRKLKKLHPDLKILWSFGGWTWSGGFGQAAQDPAAFAKS
CRDLVEDPRWADVFDGIDIDWEYPNACGLTCDTSGRDAYGRLLGELRKSFGTDLVTSAIT
ADGSDGGKIDAVDYAGAAKHLDWYLPMTYDFFGAWEAKGPTAPHSPLTSYPGIPTEGFNS
DAAIAKLKGLGIPPEKLLLGIGFYGRGWTGVTQSEPGGSATGAAAGTYEAGIEDYRVLKN
SCPATGKVAGTAYAHCGTDWWSYDTPETIGTKMDYKNEQGLGGTFFWELSGDTGNGELIK
AIR
Download sequence
Identical sequences B1W4B6
WP_012381714.1.58927 WP_012381714.1.6712 gi|182439897|ref|YP_001827616.1| 455632.SGR_6104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]