SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 455632.SGR_6768 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  455632.SGR_6768
Domain Number 1 Region: 8-307
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.93e-108
Family Glutaminase 0.00000199
Further Details:      
 
Domain Number 2 Region: 336-413
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000903
Family Anti-sigma factor antagonist SpoIIaa 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 455632.SGR_6768
Sequence length 449
Comment (Streptomyces griseus NBRC 13350)
Sequence
MSAADAVTDSLQSLRDRFVGVREGRPADYIPQLALADPDAFGLALVSMDGHRYVAGEAEV
PFTLQSVSKPFVYALALSLLGLDEVSRWVGAEPSGEAFNAISLEPGTGRPANAMVNAGAI
VTTALIPDTPDDPAFDRILRCLGCFAGRELDVDEEVFSSESVTGDRNRALAYLIRSTGTM
PVDPVLAVDRYFRQCAIRVTAVDLATMAATLAYGGVNPVTRERVVSAEVAARVLAVMATC
GMYDGSGDWLLRVGLPAKSGVSGGLIAVGPARFGVATYSPPLDATGGSVRGHAALEAMSD
RYGLHLMLNPALPGSTVTLVTTADDLPSAPSAGHERVLHEQVGVVVAQGSIDFTAAERVL
YALDESGPGGGSVVLDLHDVTSVDSVARAMLHTGLARLVGDGRRAAVVDPNDLLGPADLV
RERTGQDLPRYATREGAVEGCAQALAGED
Download sequence
Identical sequences B1VMX2
455632.SGR_6768 WP_012382199.1.20467 WP_012382199.1.58927 WP_012382199.1.60218 WP_012382199.1.6712 gi|182440561|ref|YP_001828280.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]