SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 455632.SGR_777 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  455632.SGR_777
Domain Number 1 Region: 11-209
Classification Level Classification E-value
Superfamily DhaL-like 4.58e-44
Family DhaL-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 455632.SGR_777
Sequence length 221
Comment (Streptomyces griseus NBRC 13350)
Sequence
MTTTTSPDAFSTDAWMRRFVQSAQAAKGGLTSLDQEVGDGDFGINLSTGAASTLRRLDAD
PASRDDPAAPLHAAATAFLDDVGGTSGPLFGLLFQALAVAVADAGAATTPALAAGAGEGL
AAIRRVGDAAPGDKTLVDALGPAAEALLTAPADTLPGESLERAADAAWAGVRETARLRAR
MGRSSYLGSRAEGVPDPGAVGIGMLFTSARAVVEDISTLLD
Download sequence
Identical sequences B1VSQ2
455632.SGR_777 WP_012378061.1.20467 WP_012378061.1.58927 WP_012378061.1.60218 WP_012378061.1.6712 gi|182434570|ref|YP_001822289.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]