SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 4558.Sb04g025030.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb04g025030.1
Domain Number 1 Region: 676-749
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000235
Family B3 DNA binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb04g025030.1
Sequence length 762
Comment (Sorghum bicolor)
Sequence
MIGSAPDSARRKPSHDRANDEVRHGDTVVKNTKRSADAFTEKRKKKDHLYNANHGKDRDI
RNGDQRIKKSRVPAASSEKGREKGDHDLNKTSSKKKMMGVDLDKKRTVTSRRKKLERERK
KKLLINASIRKNMQRDDGEEGRIMSNYYETKVKSKKVSTTLSDKERNKEKLNKTHREKKM
QAADSKMRNHDSGVNKGKVSTTFCDKEKKRKRPSNTNSEKETAPITYAVKEKKMRTTENS
EGKCSKVLVSKVAETLVFHQGWDIFVSNHLIKWDSCERVDFNPESTNKGGRKKQAWSNMP
PDDLVITDGSSQNIDDGYYVSGECPRTKVPQTCHVTCNTKNDPKQVEHVVGSGVMAQDNN
GKSIDPQCKTKGTSPLCSKGKTLITLIDSEDSEPLEHENGDTMKLATSVADSDTSLVAVN
TNEGPIRAQSGIGNGPSVVLGDEKGSSPEIECGTKSISTTCSEGKTRSQIIITSTALLDL
HDSDEDLGRKQRTNVVPLDSITPVIDYHNHSKTDIIQNLYRKYEAPGGFRCLEKWRKDVV
NNQASLDCTVPIKPENPQKNDSMLVDGYGSIELNPVDEYICSEGNHECVQPLFTMPIKEP
SSADRVTNCGHDGTEIDYSINEKDGEHCFSKQEGRMPSNTEVPEPLLPMKDKILELDYHS
PPEINSQLCIPDTTQKWLGLSKSLSSAVIRQRRHHWDVVMLKDPMKRLWPIIYHDNPIFV
GFTAGWKHFVAANNLQTGDVCELIKESEDDEPVYSVRMCGKI
Download sequence
Identical sequences jgi|Sorbi1|5055387|Sb04g025030 4558.Sb04g025030.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]