SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 4558.Sb07g000220.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb07g000220.1
Domain Number 1 Region: 243-334
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000131
Family B3 DNA binding domain 0.0019
Further Details:      
 
Weak hits

Sequence:  4558.Sb07g000220.1
Domain Number - Region: 72-141
Classification Level Classification E-value
Superfamily FAS1 domain 0.0379
Family FAS1 domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb07g000220.1
Sequence length 352
Comment (Sorghum bicolor)
Sequence
MGQMGGPDGDGDGGGGGPHHQYHYQALLAAVQNPSQGLHPFPLPFHLPLHAGAPAAGPVV
ADADAASTHGANANAAPHSQPPRGFTDWSPSNSAFAAVAAQPAPATTNTPFHYNVPQSYA
LWTHYMLNKNVSCSTYPTQHEPLRHSHIPDKDSGCASSLGFDSFTTMSLGPNICAHMTPM
EGSISAKEPENSQDLPAVVRSSDEMDTRNSGEVHRDTAGTLPESKQSHESCASKFNSGEY
QVILRKELTKSDVANSGRIVLPKKDAEAGLPPLVQGDPLILQMDDMVLPIIWKFKYRFWP
NNKSRMYILEAAGEFVKTHGLQAGDALIIYKNSVPGKFIIRGEKSIQQTNPT
Download sequence
Identical sequences 4558.Sb07g000220.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]