SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 4558.Sb07g006170.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb07g006170.1
Domain Number 1 Region: 125-223
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-24
Family B3 DNA binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb07g006170.1
Sequence length 230
Comment (Sorghum bicolor)
Sequence
MAEATAYEEQRRRQVEANKRKLEELQLHHLSAAVREAAAAAKPSPVKKRKARVPLDAADA
VMQPLRRSGRVANLPDKPAYREEVPAFARRIRRTYGRKDLANRVYATDEARSYTISKAED
LEQELDSRFPLFIKPMTQSHVTGGFWLGLPTGFCRKHLPKRDETITLVDEDDVESNTLYL
AMKKGLSGGWRGFAIQHKLVDGDCLVFQLIERTKFKVYIIRASSYYENED
Download sequence
Identical sequences A0A1Z5R8I7
XP_002445218.1.57931 XP_021320220.1.57931 jgi|Sorbi1|5043259|Sb07g006170 4558.Sb07g006170.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]