SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 4558.Sb09g007980.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4558.Sb09g007980.1
Domain Number 1 Region: 356-420
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000294
Family B3 DNA binding domain 0.005
Further Details:      
 
Weak hits

Sequence:  4558.Sb09g007980.1
Domain Number - Region: 69-104
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0915
Family Formin homology 2 domain (FH2 domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4558.Sb09g007980.1
Sequence length 444
Comment (Sorghum bicolor)
Sequence
MINTSLGTAARAGGGGGPCFKLLASLNHRLATGCASDAVDARNHKNPRNSERMAASCQEP
EVVVVAALPCPPPPPPPMRDQEPVNNKRGCDFNGEMIWASKKQRSSIAAAREHGNAITEV
KRAAAAATSSPIAQAKRAAAAAATAATSSPIVQEPEDHSPWGSIGAALGEKKEEKLRPCI
FAAPVCGLDGLHRDSEVTVLGIALPSRRVKRPVDREHCHSAEEECWQIKRSRPCPPTMAV
CEGINRIMPSAQSTEIQEPSCRSNPVQEAKAAGPHGRETANSSGRCNTPMRPFMSLSQGL
QFLGVTDVTPVLARILTATDCCLGQSRMQFSAQEVIDSPLFSILTTDEHRSVHQLDDQNG
LELEAIDRHGYSYNMKFKYVYSIRQYRLMQAWVPFLRQNGVRQGDLVEVGAFRVDGKPVL
TLLNYATEGWIPEEIEAAKGLLML
Download sequence
Identical sequences C5YV71
4558.Sb09g007980.1 jgi|Sorbi1|5046159|Sb09g007980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]