SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 456442.Mboo_0364 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  456442.Mboo_0364
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily PIN domain-like 0.00000000000288
Family PIN domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 456442.Mboo_0364
Sequence length 124
Comment (Candidatus Methanoregula boonei 6A8)
Sequence
MASFFADSYALIEILKGNERYIPYINGNLVTTEFNICEVTFAVCRDYPDKTRQVMARVRK
MVTLLSTTDGDYCEGAAMRRKTTGAGKKLSTIDCVGYAVSRRQEIPFLTGDREFEDIEDV
EFVR
Download sequence
Identical sequences A7I573
gi|154149909|ref|YP_001403527.1| 456442.Mboo_0364 WP_011991372.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]