SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 456442.Mboo_0702 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  456442.Mboo_0702
Domain Number 1 Region: 4-141
Classification Level Classification E-value
Superfamily YutG-like 2.35e-30
Family YutG-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 456442.Mboo_0702
Sequence length 144
Comment (Candidatus Methanoregula boonei 6A8)
Sequence
MFEIETRLEKKGITLDAIVDAAMGLYVSHGMPEEQAAEDIRKKILKYLADPNVASLLLGA
VLLEEELYEHRKDSEIAEDPVFLLSDEIIGMAIAECIGGTYARFEFTRYDQKKPGILATL
GPFLDDAVAGLIAGCTSRLYSECV
Download sequence
Identical sequences A7I659
gi|154150245|ref|YP_001403863.1| WP_012106242.1.2930 456442.Mboo_0702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]