SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 456442.Mboo_1154 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  456442.Mboo_1154
Domain Number 1 Region: 120-256
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.67e-34
Family MJ1460-like 0.019
Further Details:      
 
Domain Number 2 Region: 27-135
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000123
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 456442.Mboo_1154
Sequence length 267
Comment (Candidatus Methanoregula boonei 6A8)
Sequence
MSGEKESEQECRPDATPAVGLFATPSGIRAVQSPARAKILSVLAEHELPFDEIVRQSGKA
KSTVSVQLQGLEHEGIIIGRRNPEDSRKKLFSISSPLVGNLAGVRPDLKETPEGLARLVA
GPNPFRFYRLMFRTIRVSLLSEGINIDPVLRNAGYEVGERIYSALAAPGLEEILERTTKF
WTKNNLGTLEVESTGPLVMRVYDCFECGSLPELGRPACAFDSGILQAIFTRHYRKPQQVD
ETACYAMGDDHCRFVIAPGTPGIAPSA
Download sequence
Identical sequences A7I7G1
gi|154150697|ref|YP_001404315.1| 456442.Mboo_1154 WP_012106700.1.2930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]